PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 443825
Common NameSELMODRAFT_443825
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family bZIP
Protein Properties Length: 215aa    MW: 24804.3 Da    PI: 10.1192
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
443825genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.31.1e-105199149
            XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
  bZIP_1  1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49
            e+e+kr+ r+q+NR +A  sRqRKk ++  Le k+  Le+  ++L + +
  443825 51 EEEVKRQSRLQRNRQSAWQSRQRKKWYVTGLEAKCRLLEGRCTQLEQSV 99
            789************************************9999888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001702.1E-95190IPR004827Basic-leucine zipper domain
SMARTSM003385.9E-951115IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.48453116IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.8E-1154112No hitNo description
Gene3DG3DSA:1.20.5.1706.1E-1355114No hitNo description
CDDcd147043.99E-2156106No hitNo description
PROSITE patternPS0003605973IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MTVLSDVELS DLFVGVDDDS WGRFVDEVLL SCSDPDDEQQ QQQQQQRQHD EEEVKRQSRL  60
QRNRQSAWQS RQRKKWYVTG LEAKCRLLEG RCTQLEQSVR FVSTENVVLR QEVSRLNKAA  120
KSGVAEPAVL VKGSLPLEFL SRDLSCLVNL VTLLILVWCQ IPITLVGRDQ HTPLHHPHHK  180
MKAATTRRRR RGRSRRRSRR LIANGCGHLD WIPP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1188198RRRGRSRRRSR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1581831e-125Selaginella moellendorffii clone JGIASXY-5D8, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002978316.11e-155hypothetical protein SELMODRAFT_443825
TrEMBLD8S4P41e-155D8S4P4_SELML; Putative uncharacterized protein
STRINGEFJ209731e-155(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP54681518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.12e-10bZIP family protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]